download process
gefunden in:
Musik / MP3
MP3 (all)
Club, Dance, Electro
Entspannung
Photos / Bilder
Illustration
Photographie Tricks


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

horizont runterladen

Thumbnail Schemenhaft

Schemenhaft

Fotodatenbank: Schemenhafte Landschaf, Brandenburg / Germany Fotograf: Cyrus Maroon Datum: 2009-03-19 5528 x 4146 px (frei verwendbar in allen Med......

Runterladen
53.00 EUR
Thumbnail MP3 Ami - Ami producers cut 1

Mp3 Ami - Ami Producers Cut 1

Komplettes MP3 Album von Ami Angegebene Spieldauer: 73:09 Veröffentlichungsdatum: 2006-09-20 Kurz-Beschreibung von CDbaby: mixed producers cut music, dance, ......
67.6 MB

Runterladen
8.99 EUR
Thumbnail Klangwelten Vol. 3 - ARIA

Klangwelten Vol. 3 - Aria

Genießen Sie diese klangvollen Melodien, die dazu einladen Ihre Vorhaben mit schöpferischer Freude einzuleiten. Wenn Sie in kreativen Stunden oder...
Vorschau
play button

Runterladen
9.95 EUR

Ähnliche Produkte: electronic danceelectronic technoentspannungexotische kücheexotische rezeptehorizontinternationale kücheinternationale rezepteklangweltenlandlandschaftmeermp3 albumrelaxschemenhaftstegwasserwellness