download process
gefunden in:
Dokumente / Bücher
Geschäftlich
Anleitungen & Technik
eBooks
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Alternative
Club, Dance, Electro
Hard Rock
Inspirativ
Jazz, Blues, Funk
Entspannung
Pop
Rap, Hip Hop
RnB, Soul
Programme / Tools
Geschäftlich
Internet/Netzwerk
Diverses
Online Marketing
Anleitungsfilme
Entwickler
PHP
Sammlung / Diverses
Templates / Flash


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

"Content Sites" downloads in sammlung / diverses

Thumbnail 900 Profi Scripte Paket

900 Profi Scripte Paket

Professionelle SCRIPTE für den professionellen Einsatz inkl. Master Reseller Rechten! Verkaufen Sie dieses Angebot komplett oder verkaufen Sie daraus e......

Runterladen
9.97 EUR

Ähnliche Produkte: wordpress pluginsadsense sitesaffiliate marketingcontent sitesfacebook viral scriptmarketingmoneymp3 albummrr niche sitesniche sitesresellerrock classicsystemtraffictwittervideo marketingvideoswordpress