download process
gefunden in:
Dokumente / Bücher
Geschäftlich
Anleitungen & Technik
eBooks
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Alternative
Club, Dance, Electro
Hard Rock
Inspirativ
Jazz, Blues, Funk
Entspannung
Pop
Rap, Hip Hop
RnB, Soul
Programme / Tools
Geschäftlich
Internet/Netzwerk
Diverses
Online Marketing
Anleitungsfilme
Entwickler
PHP
Sammlung / Diverses
Templates / Flash


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

"Content Sites" downloads in rnb, soul

Thumbnail MP3 Ari Gold - Ari Gold

Mp3 Ari Gold - Ari Gold

Komplettes MP3 Album von Ari Gold Kurz-Beschreibung von CDbaby: A funky smooth blend of R&B, Pop, Soul and Dance with thick...
42.3 MB

Runterladen
8.99 EUR

Ähnliche Produkte: wordpress pluginsadsense sitesaffiliate marketingcontent sitesfacebook viral scriptmarketingmoneymp3 albummrr niche sitesniche sitesresellerrock classicsystemtraffictwittervideo marketingvideoswordpress