download process
gefunden in:

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

webvorlagen runterladen

Thumbnail HTML + PSD Web Templates

Html + Psd Web Templates

Erstellen von professionellen Webseiten war noch nie so einfach! Diese Templates ist bereits fix und fertig in HTML umgesetzt, Sie...

3.50 EUR

Ähnliche Produkte: grafikenheaderhtmltemplatetemplateswebdesignwebvorlagen