download process
gefunden in:
Dokumente / Bücher
Geschäftlich
eBooks
Filme / Video
Anleitungsfilme
Musik / MP3
MP3 (all)
Club, Dance, Electro
Programme / Tools
Geschäftlich
Online Marketing
Grafik Software
Entwickler
PHP
Templates / Flash


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

"Webdesign" downloads in musik / mp3

Thumbnail MP3 Alex Seifert - The Corridor

Mp3 Alex Seifert - The Corridor

Komplettes MP3 Album von Alex Seifert Angegebene Spieldauer: 79:50 Veröffentlichungsdatum: 2006-07-27 Kurz-Beschreibung von CDbaby: A new style for me. It ha......
73.8 MB

Runterladen
8.99 EUR

Ähnliche Produkte: web-projekteanleitungbannerebookgeldgeld verdienengrafikhomepagejoomlalanding pagesmp3 albummrr landing pagesresellerreseller produktetemplatetemplatesverdienenwebdesign