download process
gefunden in:
Dokumente / Bücher
Filme / Video
Musik / MP3
MP3 (all)
Club, Dance, Electro
Programme / Tools
Online Marketing
Grafik Software
Templates / Flash

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

"Webdesign" downloads in dokumente / bücher

Thumbnail Blog dich Reich.

Blog Dich Reich.

Ein Blog ist ursprünglich ein auf einer Internetseite geführtes und damit öffentlich einsehbares Tagebuch oder Journal. In der Zwischenzeit bieten...

9.00 EUR
Thumbnail Blog dich reich e-lizenz

Blog Dich Reich E-lizenz

Ein Blog ist ursprünglich ein auf einer Internetseite geführtes und damit öffentlich einsehbares Tagebuch oder Journal. In der Zwischenzeit bieten...

5.00 EUR

Ähnliche Produkte: web-projekteanleitungbannerebookgeldgeld verdienengrafikhomepagejoomlalanding pagesmp3 albummrr landing pagesresellerreseller produktetemplatetemplatesverdienenwebdesign