download process
gefunden in:
Dokumente / Bücher
Geschäftlich
eBooks
Musik / MP3
MP3 (all)
Rap, Hip Hop
Photos / Bilder
Abstrakt
Illustration
Photographie Tricks
Sport
Spass
Programme / Tools
Geschäftlich
Internet/Netzwerk
Musik/Multimedia
Online Marketing
Schrift/Fonts
Entwickler
HTML / xHTML
PHP
Sammlung / Diverses
Templates / Flash
Diverses


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

psd runterladen

Thumbnail PSD BlowOut - the ultimate package

Psd Blowout - The Ultimate Package

The complete package !
1. PSD Ebay Profit Pack Graphics
play button

PSD_BLOWOUT.zip   0.0913601 MB

Runterladen
9.95 USD (7.76 EUR)
Thumbnail LOGO! - Firmenlogo 1009

Logo! - Firmenlogo 1009

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1028

Logo! - Firmenlogo 1028

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1045

Logo! - Firmenlogo 1045

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1058

Logo! - Firmenlogo 1058

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1071

Logo! - Firmenlogo 1071

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1086

Logo! - Firmenlogo 1086

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1099

Logo! - Firmenlogo 1099

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR
Thumbnail LOGO! - Firmenlogo 1111

Logo! - Firmenlogo 1111

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

Runterladen
89.00 EUR

Ähnliche Produkte: designfirmafirmenlogofunhtmllayerslayoutlogologofactorymrr website templatephotoshoppsdpsd headerreseller websitetemplatetemplatesvisitenkartewebsite template