download process
gefunden in:
Dokumente / Bücher
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Rap, Hip Hop
Photos / Bilder
Photographie Tricks
Programme / Tools
Online Marketing
Sammlung / Diverses
Templates / Flash

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

psd runterladen

Thumbnail PSD BlowOut - the ultimate package

Psd Blowout - The Ultimate Package

The complete package !
1. PSD Ebay Profit Pack Graphics
play button   0.0913601 MB

9.95 USD (7.76 EUR)
Thumbnail LOGO! - Firmenlogo 1009

Logo! - Firmenlogo 1009

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1028

Logo! - Firmenlogo 1028

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1045

Logo! - Firmenlogo 1045

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1058

Logo! - Firmenlogo 1058

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1071

Logo! - Firmenlogo 1071

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1086

Logo! - Firmenlogo 1086

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1099

Logo! - Firmenlogo 1099

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

89.00 EUR
Thumbnail LOGO! - Firmenlogo 1111

Logo! - Firmenlogo 1111

Ihr eigenes Firmenlogo zum Selbstgestalten! .PSD Photoshop Format frei editierbar Design by LOGO!facTory Frei verwendbar - Lizenzfrei

89.00 EUR

Ähnliche Produkte: designfirmafirmenlogofunhtmllayerslayoutlogologofactorymrr website templatephotoshoppsdpsd headerreseller websitetemplatetemplatesvisitenkartewebsite template