download process
gefunden in:
Dokumente / Bücher
Musik / MP3
MP3 (all)
Notenblätter / Noten
Programme / Tools
Online Marketing

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

nerven runterladen


Stopp Babyschrei!

Ein Baby ist wie ein neues Leben. Es verändert den bisherigen Rhythmus total. War der Weg dorthin in neun Monaten...

8.90 EUR
Thumbnail SmartDD Deutsche Version

Smartdd Deutsche Version

vollautomatisierter Versand von digitalen Produkten. Sparen Sie nicht nur jede Menge Nerven, sondern auch viel Arbeit, Zeit und Geld! Effektivieren Sie...

6.90 EUR

Ähnliche Produkte:babycashebookgeld verdienenmarketingpaypalphp-scriptplr lizenzresellerscript, software, paypal,smartddsmartdd deutsche versionsmartdd litesmartdd lite scripttippstrocken werden kindwebmaster