download process
gefunden in:
Dokumente / Bücher
Anleitungen & Technik
Programme / Tools

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

nachschlagewerk runterladen

Thumbnail Fischer Weltalmanach 2012

Fischer Weltalmanach 2012

Der Fischer Weltalmanach 2012 & Atlas Immer auf dem neuesten Stand im weltpolitischen Geschehen das umfangreiche Nachschlagewerk Fischer Weltalmanach 2......

14.90 EUR
Thumbnail Der Fischer Weltalmanach 2008

Der Fischer Weltalmanach 2008

Immer auf dem neuesten Stand im weltpolitischen Geschehen das renommierte Jahrbuch Der Fischer Weltalmanach 2008 auf CD-ROM versorgt Sie ausführlich...

14.95 EUR
Thumbnail Das Jagdlexikon

Das Jagdlexikon

Für Jäger, Förster und Hobbyisten: Das neue Kosmos Jagdlexikon zum Sofort-Download: Die ganze Welt des Waidwerks in rund 13.000 Stichwörtern ...

43.00 EUR
Thumbnail 99 Historische Internationale Patente

99 Historische Internationale Patente

Erfahren Sie mehr über technische Geräte und Erfindungen des letzten Jahrhunderts. Eine unverzichtbare und wertvolle Dokumentation hochinteressanter Technikg......

14.95 EUR
Thumbnail Arzttricks


Vorwort WARNUNG! Dies ist ein Buch, in dem steht, wie du leicht zu einer Krankschreibung kommen kannst; es ist kein medizinisches Nachschlagewerk!! Wenn du...

7.00 EUR

Ähnliche Produkte: computerebayebookebook geschaeftsideeexistenzgruendungexistenzgründunggeschäftsideenachschlagewerkpatentschmucksoftwaretechniktextilienuhrenunited soft mediawerbungwissen