download process
gefunden in:
Dokumente / Bücher
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Podcasts, Hörbücher

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

klangwelten runterladen

Thumbnail Klangwelten Vol. 1 - SERENADE

Klangwelten Vol. 1 - Serenade

Genießen Sie diese gefühlvollen Melodien, die dazu einladen, die Zeit für wohltuende Erholung einzuleiten. Wenn Sie in ruhigen Abendstunden oder...
play button

9.95 EUR
Thumbnail Klangwelten Vol. 2 - ELEGY

Klangwelten Vol. 2 - Elegy

Genießen Sie diese stimmungsvollen Melodien, die dazu einladen, den Tag kraft- und schwungvoll einzuleiten. Wenn Sie in frühen Morgenstunden oder...
play button

9.95 EUR
Thumbnail Klangwelten Vol. 3 - ARIA

Klangwelten Vol. 3 - Aria

Genießen Sie diese klangvollen Melodien, die dazu einladen Ihre Vorhaben mit schöpferischer Freude einzuleiten. Wenn Sie in kreativen Stunden oder...
play button

9.95 EUR
Thumbnail Klangwelten Vol. 3 - Nordlichter

Klangwelten Vol. 3 - Nordlichter

Genießen Sie diese gefühlvollen Melodien, die dazu einladen, die Zeit für wohltuende Erholung einzuleiten. Wenn Sie in ruhigen Abendstunden oder...
play button

8.59 EUR
Thumbnail Zeitmanagement - Freiräume schaffen

Zeitmanagement - Freiräume Schaffen

Dieses Hörbuch ist für diejenigen gedacht, die kontinuierlich das Gefühl der Überlastung im Alltag verspüren und sich intensiver Gedanken über...
play button

9.95 EUR
Thumbnail Wavemusik - DREAMSCAPES Vol. 1

Wavemusik - Dreamscapes Vol. 1

DREAMSCAPES Vol. 1 Dreamscapes Vol.1 ist eine neue Compilation unseres Labels ArtSound Media. Lassen sie sich in eine Welt zwischen Cafe Del...
play button

9.95 EUR

Ähnliche Produkte: besinnenenergieentspannenentspannungentspannungsmusikerfolgreichfreiraumklangweltenlernenlerntechnicklerntechniklerntypmotivationrelaxselbstbewusstseinwellnesszeitzeitmanagement