download process
gefunden in:
Dokumente / Bücher
Anleitungen & Technik
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Club, Dance, Electro
Jazz, Blues, Funk
Royalty Free Produktion
Podcasts, Hörbücher
Notenblätter / Noten
Programme / Tools
Soundeffekte / MIDI
Sound Entwicklung

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

instrumente runterladen

Thumbnail AUDIO CLIP: Stimmen der Instrumente

Audio Clip: Stimmen Der Instrumente

Sound Effekt Geraeusch erkennen Stimmen der Instrumente vor dem Konzert WAV file format zum Runterladen (Sofort-Download) - Smart Sound - zur...
play button

9.95 EUR
Thumbnail MP3 Au - Alchimia

Mp3 Au - Alchimia

Komplettes MP3 Album von Au Kurz-Beschreibung von CDbaby: Progressive Electronica Käufer, die sich für (Portis Head Dead Can Dance Joy...
47.1 MB

7.92 EUR
Thumbnail Trompete Posaune Tuba Technik

Trompete Posaune Tuba Technik

Trompete Technik Umfang: 49 Patentschriften - zusammen 998 Seiten bei Papierausdruck. Beschreibung des Inhalts: Technik Kompendium rund um Trom......

16.95 EUR
Thumbnail Melody LoopPack v1.0

Melody Looppack V1.0

Dieses Pack beinhaltet verschiedene Bass Loops, Glocken, Bellz, Geigen und andere Instrumente aus dem Bereich Orchester. ============================== ===......

9.95 EUR
Thumbnail Klangwelten Vol. 3 - Nordlichter

Klangwelten Vol. 3 - Nordlichter

Genießen Sie diese gefühlvollen Melodien, die dazu einladen, die Zeit für wohltuende Erholung einzuleiten. Wenn Sie in ruhigen Abendstunden oder...
play button

8.59 EUR
Thumbnail Force Majeure Vol. 1 - Windstille

Force Majeure Vol. 1 - Windstille

FORCE MAJEURE - HORIZONTE ist eine Sammlung sehr abwechslungsreicher, sphärischer und besinnlicher Klangräume. Geschaffen um eine Insel der Entspannung ens......
play button

8.59 EUR
Thumbnail Zeitmanagement - Freiräume schaffen

Zeitmanagement - Freiräume Schaffen

Dieses Hörbuch ist für diejenigen gedacht, die kontinuierlich das Gefühl der Überlastung im Alltag verspüren und sich intensiver Gedanken über...
play button

9.95 EUR
Thumbnail NIGHT Dreams

Night Dreams

Leben im Einklang mit der Natur Urlaub vorbei? Nocheinmal nachts am Strand stehen, in den Himmel blicken, träumen und dem Grillenzirpen lauschen? Und p......
play button

9.95 EUR
Thumbnail RAIN Dreams

Rain Dreams

Leben in Einklang mit der Natur Regen ist zur Entspannung oder als Einschlafhilfe sehr gut geeignet. Gleichmäßige Regengeräusche überdecken nicht nur O......
play button

9.95 EUR
Thumbnail TROPICAL Dreams

Tropical Dreams

Leben in Einklang mit der Natur Azurblaue Lagune, riesige Südsee, weißer Sandstrand, Palmen, fremdartige Tiergeräusche - Erinnerungen an den letzten Url......
play button

9.95 EUR

Ähnliche Produkte: technikenergieentspannungentspannungsmusikerfolgreichfilm geraeusch wavklangweltenlernenlerntechnicklerntypmp3 albumnaturpatentepianorelaxsound-pool24video musikwellness