download process
gefunden in:
Dokumente / Bücher
Hörbücher: Lernen
Filme / Video
Photos / Bilder
Programme / Tools
Online Marketing
Templates / Flash

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

facebook runterladen

Thumbnail 30 PHP Clone Scripts!

30 Php Clone Scripts!

30 PHP Clone Script Erstellen Sie eine profitable Webseite wie Z.B. Google, Myspace, Youtube in wenigen Minuten. Sehr geeignet für...

9.95 EUR
Thumbnail Clickbank Affiliate Shop - mit MRR!

Clickbank Affiliate Shop - Mit Mrr!

Clickbank Affiliate Shop mit Master reseller Rechten! "Verbessern Sie Ihre Geldbörse mit diesem einzigartigen Instant-Clickbank Shop Mit mehreren Cli......

9.95 EUR
Thumbnail CMS System Professional

Cms System Professional

Das professionelle Content Management System für jedermann Die eigene Webseite - nie war es einfacher als heute! Gestalten Sie Ihren professionellen In......

53.00 EUR

Ähnliche Produkte: anzeigenmarktebookfacebookfacebook adsfacebook anzeigenfacebook appfacebook fanpagefacebook marketingfacebook scriptfacebook shopfacebook webprojektfacebook werbunglike scriptmarketingphp-scriptresellertrafficwebseite