download process
gefunden in:
Dokumente / Bücher
Geschäftlich
Anleitungen & Technik
eBooks
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Alternative
Club, Dance, Electro
Hard Rock
Inspirativ
Jazz, Blues, Funk
Entspannung
Pop
Rap, Hip Hop
RnB, Soul
Programme / Tools
Geschäftlich
Internet/Netzwerk
Diverses
Online Marketing
Anleitungsfilme
Entwickler
PHP
Sammlung / Diverses
Templates / Flash


Shopper Award

Publish

Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!
Registrieren

content sites runterladen

Thumbnail Web Developers Pack

Web Developers Pack

The Web Developers Pack Php Script is a set of tools prepared to satisfy all your web promotion and backlink...

Runterladen
43.00 USD (33.67 EUR)
Thumbnail AutomaticAdenseBlogBuilder

Automaticadenseblogbuilder

"Now You Can Combine The Power Of RSS, Automatically Updating Keyword Rich Content, And Adsense To Build Niche Dominating Sites...

Runterladen
101.00 USD (83.75 EUR)

Ähnliche Produkte: wordpress pluginsadsense sitesaffiliate marketingcontent sitesfacebook viral scriptmarketingmoneymp3 albummrr niche sitesniche sitesresellerrock classicsystemtraffictwittervideo marketingvideoswordpress