download process
gefunden in:
Dokumente / Bücher
Anleitungen & Technik
Hörbücher: Lernen
Musik / MP3
MP3 (all)
Club, Dance, Electro
Hard Rock
Jazz, Blues, Funk
Rap, Hip Hop
RnB, Soul
Programme / Tools
Online Marketing
Sammlung / Diverses
Templates / Flash

Shopper Award


Händler auf tradebit bekommen mit dem Account auch eine kostenlose Sub-Domain, die ganz einfach individualisiert werden kann. Jetzt ausprobieren!

content sites runterladen

Thumbnail Web Developers Pack

Web Developers Pack

The Web Developers Pack Php Script is a set of tools prepared to satisfy all your web promotion and backlink...

43.00 USD (33.67 EUR)
Thumbnail AutomaticAdenseBlogBuilder


"Now You Can Combine The Power Of RSS, Automatically Updating Keyword Rich Content, And Adsense To Build Niche Dominating Sites...

101.00 USD (83.75 EUR)

Ähnliche Produkte: wordpress pluginsadsense sitescontent sitesebookmarketingmoneymp3 albummrr niche sitesniche sitespop britishresellerrock classicsystemtraffictwittervideo marketingvideoswordpress